theexnmlnor TMym101m 11 EVENING on NEws HOLLYWOOD SQUARES DEFINITION POLKA DOT DOOR me NEWS 630 Nac NEws MARY TYLER MOORE SHOW ces NEws Aac NEws NEws PARTY GAME DRAGONS WAGONS ANo wa 645 II REAOALONG 655 WRITE ONI 100 OATING GAME LITTLE HOUSE ON THE PRAIRIE cnoss WITS MARY TYLER MOORE snow Tic TAc DOUGH DOWNRIGHTDISCOGqu Love Committee Suranne Stevens Glen Ricketta Shooter Repeal NEWLYWED GAME KIDSWORLD GONG SHOW PRICE IS RIGHT 730 MUPPETS SHOW NEWLYWED GAME UPPETSSHOWGUMILealeyAnn ren FAMILY FEUD PATSY GALLANT SHOW Gueafa reen Debra Waehin ton Repeat PETER APPL YARD MAGIC SHADOWS BOB NEWHART SHOW 800 THE RUNAWAYS high school track alar bedeviled by doubts about his mae culinity ia befriended by psychologist Steve Ariulo when the boys lather realizes his aon not confide in him 80 mina TESTIMONY OF TWO MEN THE PAPER CHASE Susan Howard television gUide TUESDAY EVENING VIEWING guest alara aa glam becma romantically lrwotvedwithflanandlhendropatheatming nova that one In the dreaded Prolaaaor Kings Ue daughter so rniria THE UPC LINE Alberlae Ben eflt When Mike diacovera that old Albert in not calling retirement preaent alter 35 year of dedlceted aervlca he decidea to do aomethmg Mt rl HAPPY DAYS Enioyinga wild vacation at dude ranch Richie and the Font end up in love triangle as they Vie for the allectioria of uliIul in at do mine MO IE DRAMA Vi Th0 ncocka me DIFFERENT FOLKS WHAT WILL THEY THINK OF NEXT MOVIE ADVENTURE Cry Of The Pengulna 1013 830 THE RARE BREED Alooli althehec tic Iivea of Dra Don James and Ewan Ferguson veterinarians of Campbelllord Ontario whose practiceiamainlyaervingdalrylarrneraworking around the clock to respond to sudden enciaa lb yrHE REAL STORY LEONARD 900 BIG EVENT MOVIE Farewell My Lovely 1975 Stars Robert Mitchum Charlotte Rampling In the course of tracking down an alualve woman named Valda legendary detec live Philip Marlowe uncovers wealth of inlor mation about corruption in the back street at elea in the 1940s hra CBC FILM FESTIVAL The Clown Murdera Susan Keller AI Waxnian auepenae thriller about practical Iolre at Halloween party lhat aoon turns into complex at kidna ing and murder hrs TUE BAY NIGHT MOVIE lnlernecineProiecI1974 Stars JamesCoburn Grant THREESCOMPANY WhenJanelia terrilied by theme in her bedroom Jack takes advantage at the ailuation by oliering to switch bedIwilhherandtomoveinwithChIieayuntIllhe ent Ia ca tiired Repeat CHA LIES ANGELS NOVA CAPTIONED Htllera Sa IWeapon E5 MARY AND MICHAEL 930 TAXITonysInendahipwitheobbycomea lo an end when he returns Irom an outoIlown boxing match to discover that Bobby has al lowed hia prized pet fish to die at starvation peat TAXITonyalriendehipwithaobbycomes to an end when he returns from an outoftowri boxlng match to discover that Bobby whom he entruetad with hie prized pet nah has allowed In to die of alarvalion Repeat Deaf Dr Ruble Please 8X MY COUNTRY plain what hysteroscopy is 1°=°° JFC JULIE FARR Mo mum rs Hystemn refers to the aavalheIiiectawomanatrickenbyamyaterioua ailment unaware that Dr Blake Simmona haa uterus wombgt HystemSCOP recommended herto become chieI on internal is way of examining the inside cneeo rI oUINCnYntsuincyaonemancrueadelo the womb With Specal atop an unscrupulous plastic aurgeon aeama insuument uterus doomeduhlilhemaelslhelalellVIclimalormar Is an Internal organ with cen movie etar whoae vanity makeaher reluctant to Rotumomi tral caVIty It is In the caVIty Bylaul Ruble MD ThePocfor Says Explain meaning of hysteroscopy lung where the egg is implanted and MENOF IDEAS the fetus begins growth This NEWS UPDATE area is impossible to view with NEWS out special instruments to enter 1001 it The doctor can see if there BILLY GRA1I3AI2CRUSADE are any abnormalities in uterus develo ment or rowths that PROGRAM1UNNOUNCED may hampefng pregnan CIes gagugags Regular readers will remem CTV News ber the laproscope examination EDUCATION OF MIKE MCMANUS MOVIE SUSPENSEDRAMA Bad Day at Black Rock 1055 1120 NEws 1125 NEws 1127 NEws 1130 THE TONIGHT SHOWaosI OlCar aon Gueete Shecky Greene Paul Williams um Devane Re eat 90 mine CBS LAT MOVIE BARNABY JONES Dead ManeRunJeesica Waltergueet stars as the wile of comptroller who embez zeled lot of money and is then supposedly killed in car accident Repeal COBWEB Stars Richard Widmark Lauren Bacall MOVIE ADVENTUREDRAMA Ea 1971 STREET TALK NIGHTMUSIc 1200 MOVIE ORAMA Castle no 1969 MEDICAL CENTER historically speaking today in history Selkirk Settlers Defeated At Battle of Seven Oaks Lord Selkirk Scottish landowner was one of Canadas greatest benefactors He established the colony at Red River in 1812 that eventually transformed the Prairies from furs to farming The venture cost him his life as well as most of his fortune His colonists were savagely attacked by members of the North West Company who feared that the introduc tion of agriculture on the Prairies would lead to the end of the fur trade Selkirk himself was criticized even in Canada Bishop Strachan referred to him as an American landjobber who pretended to be philanthropist but intended to make bi profits from land speculation One the worst attacks on the Selkirk settlers took palce on June 19 1816 group of about 70 NorWesters and Metis had seized two Hudsons Bay Company posts at QuAppelle and Brandon They were returning to the fort Garry area and passed close to Selkirks headquarters Fort Douglas Governor Semple went out with 26 men to investigate and someone fired shot There was brief battle in which Semple and 20 Selkirk settlers were killed while the NorWesters and Metis lost only one man The incident became known as the Battle of Seven Oaks Cuthbert Grant the leader of the NorWesters then took possession of Fort Douglas and forced the remaining settlers to paddle to Lake Winnipeg In the meantime Lord Selkirk was on his way to Red River from Montreal When he learned what had hap pened he took possession of the NorWesters post at Fort William now Thunder Bay He arrested the NorWesters there including Simon Fraser and sent them to York under armed guard An examination of the fort unco vered supplies and mail that belonged to the Selkirk settlers but had been intercepted The North West Company was powerful in York and Montreal Selkirk was put on trial and fined 2000 pounds The North West Company was not punished for the massacre at Seven Oaks OTHER EVENTS ON JUNE 19 ismChamplain helped Hurons defeat Iroquois near mouth of Richelieu River 1719 Kelsey began voyage from Hudson Bay to try to find Northwest Passage 1721 large part of Montreal was destroyed by fire 1882 Last spike was driven for CPR section between Thunder Bay and Winnipeg 1903 Regina was incorporated 1914 Hillcrest mine explosion in Alberta killed 189 men 1917 Sir Arthur Currie became commanderinChief of Canadian Corps 1924 Postal workers went on strike until June 29 1958 Parliament approved the North American Air Defence Agreement Af garden party GovernorGeneral Edward Schreyer gets kiss from young vlslfor of garden party at Government House Sunday An estimated 6000 people offended the party on the spacious grounds CP Photo barries story June 19 1974 For the first time in the history of the Simcoe North riding 49 patients at the Adult Occupational Centre at Edgar were added to the voters list They were certified by the cen tres doctor as being of voting age competent and informal patients Representative of the Simcoe County Board of Education and county elementary teachers met but were unable to resolve the impasse over the teachers 197475 contract with the board City solicitor Rowe and city administrator Gerald Tamblyn were directed by the city development committee to begin immediately ex propriaton procedure for an easement along Kidds Creek for the construction of sanitary trunk and storm sewer Rene Brunellc provincial minister of community and social services Officially opened Parkview Centre for Seniors the former King George School on Blake Street Twinning the Imperial Theatre was approved by coun cils city development commit tee on the condition that the theatre pay the city $10000 in lieu of parking spaces According to the city building departments May monthly report the value Of permits for the first five months of 1974 stood at $97 million almost $4 million behind the total for the first five months Of 1973 Barrie had double Olympic medal winner Margaret Dickens special education student at Portage View School won pair of silver medals in the Canadian Special Olympics at Winnipeg of the inside of the abdomen There are many other scope ex aminations now possible gas troscopy stomach colo noscopy large bowel and of course cystoscopy of the urinary bladder Its tribute to modern medicine that there is virtually no square inch of the human body that cannot to day be viewed by one means or another Dear Dr Ruble am 68 and have had ringing in my ears for many years always get the same answers as soon as ask if there is anything to do for it They say NO without asking any questions If you could help in any way would appreciate it LK Ever have pair of shoes that squeaked and no matter what you did they still squeaked Perfectly fine shoes but they just squeaked Thats the way ear noises aresome times As IVe noted before in response to other ear noise questions probably the most frequent of all get there are many specific identifiable causes aspirin or quinine medicines otosclerosis aging of middle ear tissue high blood pressure even earwax cancauseit Most people have some ear noise This is demonstrated by putting them into sound proofed room by themselves Most people learn to live with this nuisance Noises are sig nificant when they reflect treatable condition high blood pressure for example Other medicines can cause ear noise or make it worse The most common causes are usu ally the less serious ones An otologist is skilled in evaluating them Dear Dr Ruble have problem hope you can help with have these white pim ples or marks of some kind un der both of my eyes My friend tells my mother they could be bad and now she is so upset If you can get rid of them please let me know how am 20 years old Miss LIP What does your friend say they are Could be whiteheads mild rash or almost any thing Some people who have high cholesterol level in their bodies develop tiny yellowish plaques layers under the skin around the eyes would not ex pect this in one so young Do the sensible thing Ease mothers anxiety and your own by having them examined by doctor BRIDGE Oswald Jacoby and Alan Sontag Deception sways the game NORTH IsIIIA WEST EAST 109 10 10 SOUTH 10 Vulnerable NorthSouth Dealer South West North East South 19 Pass Pass 2NTl Pass NT Pass Pass Pass Opening lead By Oswald Jacoby and Alan Sontag Here is hand defended some years ago by Swedish expert Ejnar Werner who sat West South ducked two spades and won the third Then he overtook his jack of clubs in order to lead the nine of diamonds for finesse against the queen The finesse worked be cause Ejnar won the trick with his ace Now declarer assumed that East held that missing queen He could count on four diamonds thrcc clubs and the major suit aces for his nine tricks So when Ejnar led the 10 of hearts after winning that diamond trick South rose with dummys acc led the eight of diamonds for what he assumed was sure thing finesse and was one down when Werner produced the queen and cashed the king of hearts remarkable defensive play that was the only way to defeat an optimistic but unbeatable notrump game since if Werner had won the first diamond with the queen South would have taken the heart finesse MIEF YOU hold 519B 9654 VQ98 01982 ¢A103 The opponents reach four spades on the sequence one spadetwo spadesfour spades California reader asks what opening lead we recommend trump Let the declarer work out his own way to play the other suits daily crossword ACROSS 45 Hawaiian Answer to Prewous Puzzle volcano CIA Mauna predecessor 47 Day Heb Smells 49 More strange Possess 52 MendaCIty Be beholden 56 Ben to 57 Sacred book 13 Feudal chief 61 Povertvaar flu mm In Bung II Bernice BedeOsoI June 20 1979 Flexibility will be your key to success this coming year be cause many unexpected changes Wlll occur This should appeal to your desire for vari ety In life GEMINI May 21June 20 Dont start any job you cant finish today especially if you were depending upon anothErs help The completion of the task will be left up to you CANCER June 21July 22 Try to stay out of group involve ments today Youll have trou ble going along with the wishes ol the majority and could cause some dissension LEO July 23Aug 22 Your carelessness is likely to be the reason for failure today If youre invalved in something important pay attention to details VIRGO Aug 23Sept 22 Mak ing lastminute changes in your plans will not gain you any advantages Follow through as you originally intended to with out the shOrtcuts LIBRA Sept 23Oct 23 Youre deluding yourself if you think your budget can handle wild spending spree Face things realistically lest you encounter big trouble SCORPIO Oct 24May 22 There is confusion surrounding the course of action you should be taking today Keep outsid ers from butting into your busi ness SAGITTARIUS Nov 23Dec 21 Mistakes are likely with your work today because you find it difficult to concentrate Take care if using tools or machinery CAPRICORN Dec 22Jan 19 Social situations could get quite muddled because of lack of organization It could be case of too many hands in the kitchen without recipe to follow AQUARIUS Jan 20Feb 19 There may not be any clearcut directives as to how to proceed to get something you want Instead of fouling things up wait till you get lead PISCES Feb 20March 20 You would find yourself running around in circles today unless you formulate game plan Why squander your time with wasted steps ARIES March 21Aprll 19 Try to avoid impulse spending today Chances are youll end up not liking what you purchased and thus waste valuable funds TAURUS April 20May 20 It might be difficult to know where your loyalties lle today Instead of being helpful you could frustrate the very person you should support BC Winthrop i745 RIDICLILOLIE HARVARD WILL NEVER ACCEPT CREEPYCRAWLJE 6000 News 8055 WE GOT AN ORDER FROM TH FRAMI6 CORPORATION FER 5000000 0197s Warner Biol Inc Hog PM on an NEA Inc Reg us Pal ott AUNT FANNY l6 COMINOTO Vlélr us DMD llamas1 HATE To TELL You THIS Bur ONCE BEGINS WITH AN 10 WHATS MY KNIGHTAND MUST ADMIT IVE GOING ON assr52 uusr SEEN BETTER SALLIES sIQE ALLIED FORTH IN QUEST or How MUCH Is THAT IN VOLLAIZE Ir CAN GET OUT OF HERE BY TOMORROW ITLL JUST COVEIZ My HO5PITAL I4 Hasten agency abbr Is Destroy SI 62 Biblical 553 16 hard character l7 Housewnfes tI 63 Language tle abbr peculiarity Between Fr 20 Puts at rest 22 Tax agency abbr 24 Killer whale 25 Kerosene 28 Contests 30 Obeyed 34 Shelley work 35 SkInny fish 36 Jane Austen tItle 37 Greek letter 39 Petticoat 41 Coal mine 42 Abominable Snowman 43 27th presudent 44 Female saInt abbr EBB II Egg II 64 Over poetic 65 Cereal gram Interna you Wm MEAN AUNT AUNT FANer EEEMA 66 Pussy cat 19 Tiny state 46 Circle 67 Cook QUIckly abbl planet Born suong 48 Possessnve DOWN yearnIng ilt $10 23 Afternoon ponour HEAVFLg AlVE Sticky stuff sleep 49 Buckeye Stare ll ANYONE DMVlAllu WHEN RVe 24 Ch no 50 Ha AUSIaIa b02129 51 Mlld lOL bHEDDlNCCZ Irish clan 25 Muck we See 26 Ought Fr 53 Some club lt Equmehmognjer 27 Lalwan abbl 6238 29 Songstress Lo 54 New lconlr Sarcastic gnn 93 55 BJOdY Electrical 31 Demo 58 Trolan units lessuggemem mountain IO Tele ram Lochgm 38 wmg Fr 59 Baby apron Scotland 40 EQYDIa W19 60 Throw SOMY MDT TOO LONG Eb THEYRE NOW IN INJURYTIME ID to Your Wedding Invitations NORTH ER Announcements Headquarters We provide loanout service 01 CD STATIONERY 29 Dunlop St 7373860 a=